Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.30)
Uniprot AC: Q2NZX8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 745-1306
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
NALRGGVIEQIDAARIVVKVNEAEIGGGTDAGVDIYNLIKYTRSNQNTCINQRPLVNVGD
VIARGDVLADGPSTDIGELALGQNMLIAFMPWNGYNFEDSILLSERVVEEDRYTTIHIEE
LTCVARDTKLGPEEISADIPNVSEQALNRLDESGVVYIGAEVRAGDIMVGKVTPKGESQL
TPEEKLLRAIFGEKASDVKDSSLRVPPGMDGTVIDVQVFTRDGIEKDKRARQIEENEIKR
VKKDFDDQFRILEAAIYARLRSQIVGKVANGGANLKKGDSVTDAYLDGLKKSDWFQLRMK
DEDAADAIERAQKQIQAHEKEFEARFADKRGKITQGDDLAPGVLKMVKVFLAVKRRIQPG
DKMAGRHGNKGVVSNVVPVEDMPYMATGESVDIVLNPLGVPSRMNIGQILEVHLGWAAKG
LGRKIQRMLEAQAAVSELRKFLDDIYNHDNAINAQRVDLSQFSDEELLNLGKNLIDGVPM
ATPVFDGASEAEIKRMLELADLPQSGQTQLYDGRTGEAFDRKTTVGYMHYLKLNHLVDDK
MHARSTGPYSLVTQQPLGGKAQ
Structures of the domain Q2NZX8 745-1306
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9f X-ray 3.95 C 745-1306 None


© NPIDB team 2003 - 2021

text