Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.18)
Uniprot AC: Q32P73
RecName: DNA-directed RNA polymerase II subunit RPB9
Begin-End: 14-51
Organism: Bos taurus
Interaction Mode:   

Sequence:
IRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS
Structures of the domain Q32P73 14-51
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5flm X-ray 3.4 I 14-51 None
5oik X-ray 3.7 I 14-51 None


© NPIDB team 2003 - 2021

text