Pfam domain
Pfam family: ParB (PF08775.12)
Uniprot AC: Q38420
RecName: ParB
Begin-End: 199-324
Organism: Escherichia phage P1
Interaction Mode:  H-Bb L-Bb 

Sequence:
FPVQSELTFSDYKTLCAVGDEMGNKNLEFDQLIQNISPEINDILSIEEMAEDEVKNKILR
LITKEASLLTDKGSKDKSVVTELWKFEDKDRFARKRVKGRAFSYEFNRLSKELQEELDRM
IGHILR
Structures of the domain Q38420 199-324
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ntz X-ray 3.35 B 199-324  H-Bb S-Bb L-Bb L-Mj 
2ntz X-ray 3.35 A 199-324  S-Bb L-Bb L-Mj 
1zx4 X-ray 2.98 A 199-324  H-Bb L-Bb 
1zx4 X-ray 2.98 B 199-324 None


© NPIDB team 2003 - 2021

text