Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: Q39204
RecName: Transcription factor MYC2
Begin-End: 452-498
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb H-Mj 

Sequence:
NHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAYINELK
Structures of the domain Q39204 452-498
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gnj X-ray 2.7 M 452-498  H-Bb H-Mj 
5gnj X-ray 2.7 N 452-498  H-Bb H-Mj 
5gnj X-ray 2.7 F 452-498  H-Bb H-Mj 
5gnj X-ray 2.7 E 452-498  H-Bb H-Mj 
5gnj X-ray 2.7 B 450-498  H-Bb H-Mj 
5gnj X-ray 2.7 A 452-498  H-Bb H-Mj 
5gnj X-ray 2.7 G 452-498  H-Bb H-Mj 
5gnj X-ray 2.7 I 450-498  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text