Pfam domain
Pfam family: Tfb5 (PF06331.14)
Uniprot AC: Q3E7C1
RecName: General transcription and DNA repair factor IIH subunit TFB5
Begin-End: 2-64
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ARARKGALVQCDPSIKALILQIDAKMSDIVLEELDDTHLLVNPSKVEFVKHELNRLLSKN
IYN
Structures of the domain Q3E7C1 2-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 X 2-64  L-Bb 
5oqj X-ray 4.7 5 2-66 None
5oqm X-ray 5.8 5 2-66 None
6gym X-ray 6.7 5 2-66 None
5sva X-ray 15.3 b 20-82 None


© NPIDB team 2003 - 2021

text