Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: Q45458
RecName: DNA polymerase I
Begin-End: 497-874
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
TKRLEQMGSELAEQLRAIEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYST
SADVLEKLAPHHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTGKVHTMFNQALTQTGRL
SSAEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELRVLAHIADDDNLIEAFQ
RDLDIHTKTAMDIFHVSEEEVTANMRRQAKAVNFGIVYGISDYGLAQNLNITRKEAAEFI
ERYFASFPGVKQYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPI
QGSAADIIKKAMIDLAARLKEEQLQARLLLQVHDELILEAPKEEIERLCELVPEVMEQAV
TLRVPLKVDYHYGPTWYD
Structures of the domain Q45458 497-874
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2hhs X-ray 1.8 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
2hvh X-ray 2.49 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2hvh X-ray 2.49 A 497-874  H-Bb S-Bb L-Bb L-Mn 
2hhq X-ray 1.8 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
2hw3 X-ray 1.98 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2hht X-ray 2.05 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text