Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: Q45782
RecName: PlcR protein
Begin-End: 10-63
Organism: Bacillus thuringiensis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
IKKIRVLRGLTQKQLSENICHQSEVSRIESGAVYPSMDILQGIAAKLQIPIIHF
Structures of the domain Q45782 10-63
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u3w X-ray 2.4 B 10-63  H-Bb H-Mj L-Bb L-Mj 
3u3w X-ray 2.4 A 10-63  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text