Pfam domain
Pfam family: Cas_Cas1 (PF01867.18)
Uniprot AC: Q46896
RecName: CRISPR-associated endonuclease Cas1
Begin-End: 123-244
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RFGEPAPARRSVEQLRGIEGSRVRATYALLAKQYGVTWNGRRYDPKDWEKGDTINQCISA
ATSCLYGVTEAAILAAGYAPAIGFVHTGKPLSFVYDIADIIKFDTVVPKAFEIARRNPGE
PD
Structures of the domain Q46896 123-244
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ds5 X-ray 2.95 D 123-244 None
5ds5 X-ray 2.95 C 122-239 None
5ds5 X-ray 2.95 C 17-126  L-Bb L-Mj L-Mn 
5ds5 X-ray 2.95 B 123-242 None
5ds5 X-ray 2.95 A 123-244 None
5ds5 X-ray 2.95 A 17-125  H-Bb L-Bb L-Mj L-Mn 
5vvl X-ray 3.31 A 17-127  H-Bb L-Bb L-Mj L-Mn 
5vvl X-ray 3.31 C 123-242  H-Bb 
5vvl X-ray 3.31 D 123-244 None
5vvl X-ray 3.31 A 123-244 None
5vvl X-ray 3.31 B 123-242 None
5vvj X-ray 3.89 A 17-128  H-Bb L-Bb L-Mj L-Mn 
5vvj X-ray 3.89 A 123-244 None
5vvj X-ray 3.89 B 121-239 None
5vvj X-ray 3.89 C 17-126  H-Bb L-Bb L-Mj L-Mn 
5vvj X-ray 3.89 D 121-239 None
5vvj X-ray 3.89 C 122-242 None
5vvk X-ray 2.9 D 123-244 None
5vvk X-ray 2.9 C 123-242  H-Bb H-Mn 
5vvk X-ray 2.9 B 121-244 None
5vvk X-ray 2.9 B 17-126 None
5vvk X-ray 2.9 A 123-242  H-Bb H-Mn 
5vvk X-ray 2.9 A 17-127  H-Bb L-Bb L-Mj L-Mn 
5dqu X-ray 4.5 A 17-126  S-Bb L-Bb L-Mj L-Mn 
5dqu X-ray 4.5 B 121-239 None
5dqu X-ray 4.5 C 121-239 None
5dqu X-ray 4.5 D 121-242 None
5dqu X-ray 4.5 A 121-240 None
5dqz X-ray 2.7 A 123-242 None
5dqz X-ray 2.7 B 123-244 None
5dqz X-ray 2.7 D 123-242 None
5dqz X-ray 2.7 C 122-239 None
5ds6 X-ray 3.35 C 122-242 None
5ds6 X-ray 3.35 C 17-126  H-Bb S-Bb L-Bb L-Mj L-Mn 
5ds6 X-ray 3.35 B 121-244 None
5ds6 X-ray 3.35 A 17-126  H-Bb S-Bb L-Bb L-Mj L-Mn 
5ds6 X-ray 3.35 A 122-242 None
5dlj X-ray 2.6 A 123-242 None
5dlj X-ray 2.6 B 123-242 None
5dlj X-ray 2.6 D 123-242 None
5dlj X-ray 2.6 C 123-242 None
5dqt X-ray 3.1 L 123-242 None
5dqt X-ray 3.1 J 123-242 None
5dqt X-ray 3.1 I 123-242 None
5dqt X-ray 3.1 K 123-242 None
5dqt X-ray 3.1 B 123-244 None
5dqt X-ray 3.1 B 17-127 None
5dqt X-ray 3.1 A 123-242 None
5dqt X-ray 3.1 C 123-242 None
5dqt X-ray 3.1 D 122-244 None
5dqt X-ray 3.1 D 17-126  H-Bb L-Bb L-Mj L-Mn 
5ds4 X-ray 3.2 A 17-126  H-Bb L-Bb L-Mj L-Mn 
5ds4 X-ray 3.2 A 122-242 None
5ds4 X-ray 3.2 C 122-242 None
5ds4 X-ray 3.2 C 17-126  H-Bb L-Bb L-Mj L-Mn 
5ds4 X-ray 3.2 B 121-244 None
5wfe X-ray 3.64 C 121-239 None
5wfe X-ray 3.64 D 123-242 None
5wfe X-ray 3.64 A 123-244  H-Bb H-Mn L-Bb 
5wfe X-ray 3.64 B 123-242  L-Bb L-Mn 
5wfe X-ray 3.64 C 17-126  H-Bb S-Bb L-Bb L-Mj L-Mn 
5wfe X-ray 3.64 A 17-128  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text