Pfam domain
Pfam family: CRISPR_Cse1 (PF09481.12)
Uniprot AC: Q46901
RecName: CRISPR system Cascade subunit CasA
Begin-End: 2-461
Organism: Escherichia coli
Interaction Mode:  S-Bb L-Bb L-Mn 

Sequence:
NLLIDNWIPVRPRNGGKVQIINLQSLYCSRDQWRLSLPRDDMELAALALLVCIGQIIAPA
KDDVEFRHRIMNPLTEDEFQQLIAPWIDMFYLNHAEHPFMQTKGVKANDVTPMEKLLAGV
SGATNCAFVNQPGQGEALCGGCTAIALFNQANQAPGFGGGFKSGLRGGTPVTTFVRGIDL
RSTVLLNVLTLPRLQKQFPNESHTENQPTWIKPIKSNESIPASSIGFVRGLFWQPAHIEL
CDPIGIGKCSCCGQESNLRYTGFLKEKFTFTVNGLWPHPHSPCLVTVKKGEVEEKFLAFT
TSAPSWTQISRVVVDKIIQNENGNRVAAVVNQFRNIAPQSPLELIMGGYRNNQASILERR
HDVLMFNQGWQQYGNVINEIVTVGLGYKTALRKALYTFAEGFKNKDFKGAGVSVHETAER
HFYRQSELLIPDVLANVNFSQADEVIADLRDKLHQLCEML
Structures of the domain Q46901 2-461
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4qyz X-ray 3.03 A 2-461 None
5h9e X-ray 3.21 A 2-461  S-Bb L-Bb L-Mn 
5h9f X-ray 2.45 A 2-461  S-Bb L-Bb L-Mn 
4u7u X-ray 3 M 2-461 None
4u7u X-ray 3 A 2-461 None
4u7u X-ray 3 A 2-461 None
4u7u X-ray 3 M 2-461 None
5cd4 X-ray 3.2 I 2-461 None
5cd4 X-ray 3.2 U 2-461 None


© NPIDB team 2003 - 2021

text