Pfam domain
Pfam family: CRISPR_Cse1 (PF09481.12)
Uniprot AC: Q47PJ1
RecName: CRISPR-associated protein, Cse1 family
Begin-End: 21-492
Organism: Thermobifida fusca
Interaction Mode:   

Sequence:
DVTIAPWLIARSRDVLAAPEMLGLRDVLIRSHELSDVEIPLPPGAAVLWRILALITARIT
GLDQPPNKNPKRKWQARRSQILSKGRLDPEAVDAYFADYSERFDLFHPERPWLQDPRLRE
ECPKTSGVNKLAWGRTAGENQVWLGGHHHDLDPHPLDSAEAVWHLLATLGYGPSGMCTAR
VVRGRSERNVTAGPLRGTVSYHPLGRTLFESLILNIPYPGTGAADLAFWEQPELNDPLGL
PEESAGLAGILRLDHFRHAVLLHPSPDGSHVVDAWVTWAWRERNISPELDPYLIYQTSKE
GRVYPRPAEAERAIWRDLDALLHYGEDGNYRPTILDNCTPLAQVPQEVLDSLRLRAFGFD
QDGQARDKQWFTATTPAVLRWLADRETDDNENARIVRRITLARKAAEALGRRLEKACKEA
WKESNSPSSTSSGTNAKTETGVGPWVQHGMSRYWAKAEPVFWNIVYDRPAQG
Structures of the domain Q47PJ1 21-492
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u0a X-ray 3.3 C 21-492  L-Bb L-Mj L-Mn 
6c66 X-ray 3.66 A 21-492  S-Bb L-Bb L-Mj L-Mn 
5u07 X-ray 3.8 C 21-492  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text