Pfam domain
Pfam family: RNase_T (PF00929.26)
Uniprot AC: Q47VZ4
RecName: Oligoribonuclease
Begin-End: 9-171
Organism: Colwellia psychrerythraea
Interaction Mode:   

Sequence:
IWLDLEMTGLEPVEDVILEIAIIITDSELNILAQGPIFAISQTDDVLDNMNPWCIEHHGK
SGLTQRCRDSEVSLAHATKESLAFVQEWVPQGKSPMCGNSIGQDRRFINKYMPDFEDHFH
YRNLDVSTIKELAKRWKPEVLESVVKTGAHLALDDIKESIAEL
Structures of the domain Q47VZ4 9-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6a4e X-ray 2.45 A 9-171 None
6a4e X-ray 2.45 C 9-171 None


© NPIDB team 2003 - 2021

text