Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: Q4D4S1
RecName: 40S ribosomal protein S9, putative
Begin-End: 106-152
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
RRLQTVVFKHGLAKSVHHARVLILQRHIAVAKQIVTIPSFIVRVSSE
Structures of the domain Q4D4S1 106-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 b 106-152 None


© NPIDB team 2003 - 2021

text