Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: Q4D6H7
RecName: Ribosomal protein S20, putative
Begin-End: 18-112
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
LVKMTSRNAKAVENVMTELLLHARNEKVVLRGPVRLPTRTLKVTTRKTPCGNGTNTWDTY
ELKIYKRLVELRAPTELVKKITSFPIDAGVDVAIT
Structures of the domain Q4D6H7 18-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 l 18-112 None


© NPIDB team 2003 - 2021

text