Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: Q4DEK4
RecName: 40S ribosomal protein S16, putative
Begin-End: 16-149
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
GKKKTAIAVATVTKAAQCNIRVNGVPVSQILPETLRAKIMEAVNVVGSRHFARLRIDVTV
RGAGQVAQAYATRQAIAKGLVAYYQKYKNEVEKAALKDKYLAYDKYLLIADPRRCEPKKW
GRHSARTRFTKSYR
Structures of the domain Q4DEK4 16-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 r 8-141 None


© NPIDB team 2003 - 2021

text