Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: Q4DTQ1
RecName: 40S ribosomal protein S23, putative
Begin-End: 29-142
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
KSHTFVAQKANPFGGSSHAKGIVLEKIGVGAKQPNSAIRKCVRVQLIKNDKKIIAFVPND
GCLHFIEENDEVLVSGFGRSGHAVGDIPGVRFKIVKVSNVGLYALYRQKKEKPR
Structures of the domain Q4DTQ1 29-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 M 29-142 None


© NPIDB team 2003 - 2021

text