Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: Q4E0N6
RecName: 40S ribosomal protein S15a, putative
Begin-End: 5-130
Organism: Trypanosoma cruzi
Interaction Mode:   

Sequence:
SVLANALRCIASAERRGKRQVLIRPSSKVVVKFLQVMQKHGYIGEFEIIDDHRAGKIVVN
LNGRLNKCGAICPRFDCTTPDFEKWVKNILPSRQFGFVVLTTSLGIMDHEEARARNTGGK
VLGFFY
Structures of the domain Q4E0N6 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5opt X-ray 4 e 5-130 None


© NPIDB team 2003 - 2021

text