Pfam domain
Pfam family: IMS (PF00817.22)
Uniprot AC: Q4JB80
RecName: DNA polymerase IV
Begin-End: 6-157
Organism: Sulfolobus acidocaldarius
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mj 

Sequence:
VDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAM
QIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIEL
ARKIKQEILEKEKITVTVGVAPNKILAKIIAD
Structures of the domain Q4JB80 6-157
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hyk X-ray 2.8 A 6-156 None
4f4w X-ray 1.9 B 6-156  S-Bb 
4f4w X-ray 1.9 A 6-156  H-Bb S-Bb 
3bq0 X-ray 2.6 A 6-156  S-Bb 
3bq1 X-ray 2.7 A 6-156 None
3bq2 X-ray 2.7 A 6-156  S-Bb L-Mj 
4f4x X-ray 2.05 A 6-156  H-Mn S-Bb L-Bb 
4nlg X-ray 2.4 A 6-156  H-Bb S-Bb 
4f4y X-ray 2.34 B 6-156 None
4f4y X-ray 2.34 A 6-156 None
4f50 X-ray 2.22 A 6-156  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text