Pfam domain
Pfam family: IN_DBD_C (PF00552.23)
Uniprot AC: Q4QY51
RecName: Integrase (Fragment)
Begin-End: 831-875
Organism: Simian T-lymphotropic virus 1
Interaction Mode:   

Sequence:
FKIPGLNSRQWKGPQRALQEAAGAALIPVSDTAAQWIPWKLLKRA
Structures of the domain Q4QY51 831-875
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6z2y X-ray 3.34 A 232-276 None
6z2y X-ray 3.34 B 232-276  S-Bb 
6z2y X-ray 3.34 D 232-276 None
6z2y X-ray 3.34 E 232-276  S-Bb 


© NPIDB team 2003 - 2021

text