Pfam domain
Pfam family: Cas_Cas1 (PF01867.18)
Uniprot AC: Q53WG8
RecName: CRISPR-associated endonuclease Cas1 2
Begin-End: 122-249
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RLYRMRFSEPLPEGLTLEQVRGLEGVRVRNAYARWSRETGVPWYGRSYDRGNWRAADPVN
RALSAGASYLYGLAHAAIVSLGFSPALGFIHTGKLLSFVYDIADLYKADYLVPAAFRTVA
ESEEAVER
Structures of the domain Q53WG8 122-249
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kdv X-ray 3.11 B 118-258 None
6kdv X-ray 3.11 A 118-254 None
6kdv X-ray 3.11 D 118-258 None
6kdv X-ray 3.11 C 118-253 None


© NPIDB team 2003 - 2021

text