Pfam domain
Pfam family: MutS_I (PF01624.22)
Uniprot AC: Q56215
RecName: DNA mismatch repair protein MutS
Begin-End: 14-125
Organism: Thermus aquaticus
Interaction Mode:  H-Bb S-Bb S-Mj S-Mn L-Bb 

Sequence:
PPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPMAGI
PLRAFEAYAERLLKMGFRLAVADQVEPAEEAEGLVRREVTQLLTPGTLLQES
Structures of the domain Q56215 14-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nne X-ray 3.11 A 14-125  H-Bb S-Bb S-Mn L-Bb 
1nne X-ray 3.11 B 1014-1125  L-Bb 
1fw6 X-ray 2.7 B 1014-1125  H-Bb S-Bb L-Bb 
1fw6 X-ray 2.7 A 14-125  H-Bb S-Bb S-Mn L-Bb 
1ewq X-ray 2.2 B 1014-1125  H-Bb S-Bb L-Bb 
1ewq X-ray 2.2 A 14-125  H-Bb S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2021

text