Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: Q58DQ5
RecName: 28S ribosomal protein S9, mitochondrial
Begin-End: 274-396
Organism: Bos taurus
Interaction Mode:   

Sequence:
GKRKTANAEAVVYGHGSGKIEINGVDYLLYFPVTQDREQLMFPFHFLDRLGKHDVTCTVS
GGGRSSQAGAIRLAMSRALCSFITEDEVEWMRQAGLLTTDPRVRERKKPGQEGARRKFTW
KKR
Structures of the domain Q58DQ5 274-396
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6nf8 X-ray 3.48 I 274-396 None
6neq X-ray 3.32 I 274-396 None
3jd5 X-ray 7 I 274-396 None


© NPIDB team 2003 - 2021

text