Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: Q58HP2
RecName: MYB24
Begin-End: 38-98
Organism: Trichomonas vaginalis
Interaction Mode:   

Sequence:
FTEEEDLKLQQLVMRYGAKDWIRISQLMITRNPRQCRERWNNYINPALRTDPWSPEEDML
L
Structures of the domain Q58HP2 38-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2kdz NMR A 4-64  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text