Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: Q58HP3
RecName: MYB21
Begin-End: 52-108
Organism: Trichomonas vaginalis
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
FTPEEDEMLKRAVAQHGSDWKMIAATFPNRNARQCRDRWKNYLAPSISHTPWTAEED
Structures of the domain Q58HP3 52-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3osg X-ray 2 D 52-110  H-Bb H-Mj 
3osg X-ray 2 A 52-108  H-Bb H-Mj L-Bb 
3osf X-ray 2.03 D 52-110  H-Bb H-Mj 
3osf X-ray 2.03 A 52-110  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text