Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: Q59961
RecName: DNA topoisomerase 4 subunit B
Begin-End: 428-540
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
ELYLVEGDSAGGSAKQGRDRKFQAILPLRGKVVNTAKAKMADILKNEEINTMIYTIGAGV
GADFSIEDANYDKIIIMTDADTDGAHIQTLLLTFFYRYMRPLVEAGHVYIALP
Structures of the domain Q59961 428-540
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3foe X-ray 4 D 428-538  L-Bb 
3foe X-ray 4 C 428-538  L-Bb 
3ksb X-ray 3.5 C 428-538  H-Bb L-Bb L-Mn 
3ksb X-ray 3.5 D 428-538  H-Bb L-Bb 
3ksa X-ray 3.3 D 428-538  H-Bb L-Bb 
3ksa X-ray 3.3 C 428-538  H-Bb L-Bb L-Mn 
3k9f X-ray 2.9 D 428-538  H-Bb S-Bb L-Bb L-Mn 
3k9f X-ray 2.9 C 428-538  H-Bb S-Bb L-Bb L-Mn 
3fof X-ray 4 C 428-538  L-Bb 
3fof X-ray 4 D 428-538  L-Bb 
3ltn X-ray 3.1 D 428-538  H-Bb S-Bb L-Bb L-Mn 
3ltn X-ray 3.1 C 428-538  H-Bb S-Bb L-Bb L-Mn 
4koe X-ray 3.02 D 428-538  L-Bb L-Mn 
4koe X-ray 3.02 C 428-538  L-Bb L-Mn 
4kpf X-ray 3.24 D 428-538  H-Bb L-Bb L-Mn 
4kpf X-ray 3.24 C 428-538  H-Bb S-Bb L-Bb L-Mn 
3rad X-ray 3.35 D 428-538  H-Bb L-Bb L-Mn 
3rad X-ray 3.35 C 428-538  H-Bb S-Bb L-Bb 
3raf X-ray 3.24 D 428-538  H-Bb S-Bb L-Bb L-Mn 
3raf X-ray 3.24 C 428-538  H-Bb S-Bb L-Bb L-Mn 
4juo X-ray 6.53 C 428-538  H-Bb S-Bb L-Bb L-Mn 
4z3o X-ray 3.44 B 428-538  H-Bb S-Bb L-Bb L-Mn 
4z3o X-ray 3.44 A 428-538  H-Bb S-Bb L-Bb L-Mn 
3rae X-ray 2.9 D 428-538  H-Bb S-Bb L-Bb L-Mn 
3rae X-ray 2.9 C 428-538  H-Bb S-Bb L-Bb L-Mn 
4z4q X-ray 3.04 B 428-538  H-Bb S-Bb L-Bb L-Mn 
4z4q X-ray 3.04 A 428-538  H-Bb S-Bb L-Bb L-Mn 
4z53 X-ray 3.26 A 428-538  H-Bb S-Bb L-Bb 
4z53 X-ray 3.26 B 428-538  H-Bb S-Bb L-Bb L-Mn 
4i3h X-ray 3.7 B 428-538  H-Bb L-Bb L-Mn 
4i3h X-ray 3.7 A 428-538  H-Bb L-Bb 
4kpe X-ray 3.43 D 428-538  H-Bb L-Bb L-Mn 
4kpe X-ray 3.43 C 428-538  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text