Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: Q59961
RecName: DNA topoisomerase 4 subunit B
Begin-End: 573-634
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:  H-Bb L-Bb 

Sequence:
KGATLQRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKW
IE
Structures of the domain Q59961 573-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3foe X-ray 4 D 574-634 None
3foe X-ray 4 C 574-634 None
3ksb X-ray 3.5 D 575-634  H-Bb L-Bb 
3ksb X-ray 3.5 C 573-634  H-Bb L-Bb 
3ksa X-ray 3.3 D 573-634  L-Bb 
3ksa X-ray 3.3 C 573-634  L-Bb 
3k9f X-ray 2.9 D 573-634  H-Bb 
3k9f X-ray 2.9 C 573-634  H-Bb L-Bb 
3fof X-ray 4 D 574-634 None
3fof X-ray 4 C 574-634 None
3ltn X-ray 3.1 C 573-634  H-Bb 
3ltn X-ray 3.1 D 573-634  H-Bb 
4koe X-ray 3.02 C 569-634  H-Bb 
4kpf X-ray 3.24 C 569-634  H-Bb 
4kpf X-ray 3.24 D 570-634  H-Bb 
3rad X-ray 3.35 D 570-634  H-Bb 
3rad X-ray 3.35 C 569-634  H-Bb 
3raf X-ray 3.24 C 569-634  H-Bb 
3raf X-ray 3.24 D 570-634  H-Bb 
4juo X-ray 6.53 C 569-634  H-Bb 
4z3o X-ray 3.44 A 569-634  H-Bb 
3rae X-ray 2.9 D 570-634  H-Bb 
3rae X-ray 2.9 C 569-634  H-Bb 
4z4q X-ray 3.04 A 569-634  H-Bb 
4z4q X-ray 3.04 B 573-634  H-Bb 
4z53 X-ray 3.26 A 569-634  H-Bb 
4z53 X-ray 3.26 B 570-634  H-Bb 
4i3h X-ray 3.7 B 577-634  H-Bb 
4i3h X-ray 3.7 A 567-634  H-Bb 
4kpe X-ray 3.43 D 570-634  H-Bb 
4kpe X-ray 3.43 C 569-634  H-Bb 


© NPIDB team 2003 - 2021

text