Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.23)
Uniprot AC: Q59961
RecName: DNA topoisomerase 4 subunit B
Begin-End: 578-634
Organism: Streptococcus pneumoniae serotype 4
Interaction Mode:   

Sequence:
QRYKGLGEMNADQLWETTMNPETRTLIRVTIEDLARAERRVNVLMGDKVEPRRKWIE
Structures of the domain Q59961 578-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4koe X-ray 3.02 D 566-634  H-Bb 
4z3o X-ray 3.44 B 565-634  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text