Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: Q5H3R9
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-62
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
DCLEVVNNRFELVMMASKRARQLANGVQPLIENAAASDKPTVMALREIAARRIDN
Structures of the domain Q5H3R9 8-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9f X-ray 3.95 E 8-62 None
6j9e X-ray 3.41 E 8-62 None


© NPIDB team 2003 - 2021

text