Pfam domain
Pfam family: RNA_pol_Rpb5_C (PF01191.21)
Uniprot AC: Q5JE31
RecName: DNA-directed RNA polymerase subunit H
Begin-End: 7-79
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
FNIFDHVLVPEHRILSEEEKEELLKKYRIRISQLPQIKASDPAVVALGAKPGDVIEIKRK
SPTAGYYYYYRLV
Structures of the domain Q5JE31 7-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 H 7-79 None


© NPIDB team 2003 - 2021

text