Pfam domain
Pfam family: RNA_pol_Rpb2_5 (PF04567.19)
Uniprot AC: Q5JE32
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 606-647
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
WSDLIRMGVIEYLDAEEEENAYVATWPWEVTEEHTHLELMPA
Structures of the domain Q5JE32 606-647
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 B 606-647 None


© NPIDB team 2003 - 2021

text