Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.22)
Uniprot AC: Q5JE33
RecName: DNA-directed RNA polymerase subunit
Begin-End: 321-487
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
GKRVNFSARTVISPDPMISINEVGVPLAVAMELTVPEKVTEFNYEKLKQRVLNGPEKYPG
ANYVIDPEGRRIRLMESNRELIAEKLDIGWTVERHLEDGDVVLFNRQPSLHRMSIMAHRV
RVMPYRTFRLNLPVCPPYNADFDGDEMNLHVPQTEEAQAEAKILMEV
Structures of the domain Q5JE33 321-487
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 A 321-487 None


© NPIDB team 2003 - 2021

text