Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.20)
Uniprot AC: Q5JE33
RecName: DNA-directed RNA polymerase subunit
Begin-End: 490-673
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
HIISPRYGGPLIAGIQDHISGGYLLTREGAYFTRYEVEQMLMFAGMDVNELPEPDKYENG
EPLWSGKTIFSLLLPDDLTIWYRNKLCDEPERCEALEKLIEEKLIPDPEEVRKLAYDGFV
YIQNGKLLSGAVDKKAYGREDGKLLDIIVREYGVERARQFLDQVTKLTIWVITHKGFTTA
IDDE
Structures of the domain Q5JE33 490-673
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 A 490-673 None


© NPIDB team 2003 - 2021

text