Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: Q5JE33
RecName: DNA-directed RNA polymerase subunit
Begin-End: 811-896
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
GLTPQEYFFHAMGGREGLVDTAVRTAQSGYMQRRLINALQDLKVDYDGTVRDPTGIIVQF
KYGEDGVDPMKSWQGKTVDVDRVIVR
Structures of the domain Q5JE33 811-896
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 A 811-876 None


© NPIDB team 2003 - 2021

text