Pfam domain
Pfam family: RNA_pol_L_2 (PF13656.8)
Uniprot AC: Q5JE88
RecName: DNA-directed RNA polymerase subunit L
Begin-End: 12-88
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
LLEFYLEGEDHTFANLLTETLHENEHVTFAGYTIEHPITMARKPRFKVVTDGKITPEKAL
EEAAQKIFDRAREVLEA
Structures of the domain Q5JE88 12-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 L 12-88 None


© NPIDB team 2003 - 2021

text