Pfam domain
Pfam family: RNA_pol_Rpb4 (PF03874.18)
Uniprot AC: Q5JI52
RecName: DNA-directed RNA polymerase, subunit F
Begin-End: 11-114
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
YITIAEAKELLERRHAEGLAENPEEPMFYEARVSLEHAERFAKLKPEQARELKEKLMGLF
DWINERIAAKLVDILPEDYLDIRVIFAKEEYMPTPEEAEEIIKV
Structures of the domain Q5JI52 11-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 F 11-119 None


© NPIDB team 2003 - 2021

text