Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: Q5JIY4
RecName: DNA-directed RNA polymerase, subunit E
Begin-End: 78-159
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
EPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLK
LGDYVRARIIGVSVKSRVIREN
Structures of the domain Q5JIY4 78-159
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 E 78-159 None


© NPIDB team 2003 - 2021

text