Pfam domain
Pfam family: SHS2_Rpb7-N (PF03876.19)
Uniprot AC: Q5JIY4
RecName: DNA-directed RNA polymerase, subunit E
Begin-End: 8-64
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
KDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDG
Structures of the domain Q5JIY4 8-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 E 8-64 None


© NPIDB team 2003 - 2021

text