Pfam domain
Pfam family: RNA_pol_N (PF01194.19)
Uniprot AC: Q5JJC9
RecName: DNA-directed RNA polymerase subunit N
Begin-End: 2-59
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
IVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLLSHVELIDQV
Structures of the domain Q5JJC9 2-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 N 2-59 None


© NPIDB team 2003 - 2021

text