Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: Q5JJD0
RecName: DNA-directed RNA polymerase subunit K
Begin-End: 3-51
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
RYTRFEKARIIGARALQIAMGAPVLIDVPEGITPLQAALLEFEKGVIPI
Structures of the domain Q5JJD0 3-51
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 K 3-51 None


© NPIDB team 2003 - 2021

text