Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: Q5JJF4
RecName: DNA-directed RNA polymerase subunit D
Begin-End: 15-247
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
KFIVSGVDVPFANALRRTILSEVPTFAVDEVEFLENDSALFDEIIAHRLAMIPLTTPHER
FSLDALELDDYTVTLSLEAEGPGMVYSGDLKSSDGDVKPANPNIPIVKLAEGQRLTFNAY
ARLGRGKDHAKWQPGFVYYKYLTKIHVSKDVPDWEELKELAERRGLPVEESDEEIVITTI
KAFYLPRKFEEHMGKGIREEIVPGSFVFTVETNGELPVEEIVSIALKILMRKS
Structures of the domain Q5JJF4 15-247
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 D 15-247 None


© NPIDB team 2003 - 2021

text