Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: Q5JJF4
RecName: DNA-directed RNA polymerase subunit D
Begin-End: 45-147
Organism: Thermococcus kodakarensis
Interaction Mode:   

Sequence:
VEFLENDSALFDEIIAHRLAMIPLTTPHERFSLDALELDDYTVTLSLEAEGPGMVYSGDL
KSSDGDVKPANPNIPIVKLAEGQRLTFNAYARLGRGKDHAKWQ
Structures of the domain Q5JJF4 45-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kf9 X-ray 3.79 D 45-147 None


© NPIDB team 2003 - 2021

text