Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: Q5KWC1
RecName: DNA polymerase I
Begin-End: 499-876
Organism: Geobacillus kaustophilus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
TKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYST
SADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFR
RDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFI
ERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPI
QGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYD
Structures of the domain Q5KWC1 499-876
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ds5 X-ray 1.68 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
4ds5 X-ray 1.68 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1ua0 X-ray 2.1 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1njw X-ray 1.9 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4ds4 X-ray 1.68 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4ds4 X-ray 1.68 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4e0d X-ray 1.58 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4dqi X-ray 1.69 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqi X-ray 1.69 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dsf X-ray 1.66 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqq X-ray 1.59 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqq X-ray 1.59 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4dqp X-ray 1.74 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqp X-ray 1.74 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqs X-ray 1.66 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dse X-ray 1.67 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqr X-ray 1.95 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dqr X-ray 1.95 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4f3o X-ray 1.57 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4f3o X-ray 1.57 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4f8r X-ray 1.64 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4f4k X-ray 1.6 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4f4k X-ray 1.6 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4ez6 X-ray 1.64 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4f2r X-ray 1.63 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4f2r X-ray 1.63 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3pv8 X-ray 1.52 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3pv8 X-ray 1.52 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4ez9 X-ray 1.64 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4ez9 X-ray 1.64 D 497-874  H-Bb S-Bb L-Bb L-Mn 
2hhv X-ray 1.55 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
2hhx X-ray 2.26 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
3px6 X-ray 1.59 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3px6 X-ray 1.59 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
4f2s X-ray 1.65 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4f2s X-ray 1.65 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3px0 X-ray 1.73 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3px0 X-ray 1.73 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2hvi X-ray 1.98 A 497-874  H-Bb S-Bb L-Bb L-Mn 
2hvi X-ray 1.98 D 497-874  H-Bb S-Bb L-Bb L-Mn 
3hp6 X-ray 1.81 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
3hp6 X-ray 1.81 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2hhu X-ray 1.8 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3px4 X-ray 1.58 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2hhw X-ray 1.88 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
2hhw X-ray 1.88 D 497-874  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text