Pfam domain
Pfam family: PHP (PF02811.21)
Uniprot AC: Q5L0J3
RecName: DNA polymerase III PolC-type
Begin-End: 344-702
Organism: Geobacillus kaustophilus
Interaction Mode:   

Sequence:
ELHLHTPMSQMDAVTSVTKLIEQAKKWGHPAIAVTDHAVVQSFPEAYSAAKKHGMKVIYG
LEANIVDDGVPIAYNETHRRLSEETYVVFDVETTGLSAVYNTIIELAAVKVKDGEIIDRF
MSFANPGHPLSVTTMELTGITDEMVKDAPKPDEVLARFVDWAGDATLVAHNASFDIGFLN
TGLARMGRGKIANPVIDTLELARFLYPDLKNHRLNTLCKKFDIELTQHHRAIYDAEATGH
LLMRLLKEAEERGILFHDELNSRTHSEASYRLARPFHVTLLAQNETGLKNLFKLVSLSHI
QYFHRVPRIPRSVLVKHRDGLLVGSGCDKGELFDNLIQKAPEEVEDIARFYDFLEVHPP
Structures of the domain Q5L0J3 344-702
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3f2b X-ray 2.39 A 344-729 None
3f2c X-ray 2.5 A 344-729 None
3f2d X-ray 2.51 A 344-729 None


© NPIDB team 2003 - 2021

text