Pfam domain
Pfam family: DNA_pol3_alpha (PF07733.14)
Uniprot AC: Q5L0J3
RecName: DNA polymerase III PolC-type
Begin-End: 831-1027
Organism: Geobacillus kaustophilus
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
EEIREMSYRRAKEIYGDPLPKLVEERLEKELKSIIGHGFAVIYLISHKLVKKSLDDGYLV
GSRGSVGSSFVATMTEITEVNPLPPHYVCPNCKHSEFFNDGSVGSGFDLPDKNCPRCGTK
YKKDGHDIPFETFLGFKGDKVPDIDLNFSGEYQPRAHNYTKVLFGEDNVYRAGTIGTVAD
KTAYGFVKAYASDHNLE
Structures of the domain Q5L0J3 831-1027
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3f2b X-ray 2.39 A 831-1027  H-Bb S-Bb L-Bb L-Mn 
3f2c X-ray 2.5 A 831-1027  H-Bb S-Bb L-Bb L-Mn 
3f2d X-ray 2.51 A 831-1027  H-Bb S-Bb L-Mn 


© NPIDB team 2003 - 2021

text