Pfam domain
Pfam family: z-alpha (PF02295.19)
Uniprot AC: Q5NE14
RecName: Protein kinase-containing Z-DNA-binding domains
Begin-End: 9-68
Organism: Danio rerio
Interaction Mode:   

Sequence:
EIEMRICDYLRRHGRSTVQDIFKELKLEKSTVNRHLYSLQASKQVFKTVEDNKRPVWNLV
Structures of the domain Q5NE14 9-68
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4lb6 X-ray 1.8 B 7-69 None
4lb5 X-ray 2 A 9-68 None
4lb5 X-ray 2 B 7-69 None


© NPIDB team 2003 - 2021

text