Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q5QNW6
RecName: Histone H2B type 2-F
Begin-End: 34-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
EIQTAVRLL
Structures of the domain Q5QNW6 34-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6mup X-ray 3.5 H 33-101 None
6mup X-ray 3.5 D 33-101 None
6muo X-ray 3.6 H 33-101 None
6muo X-ray 3.6 D 33-101 None


© NPIDB team 2003 - 2021

text