Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: Q5SKW1
RecName: RNA polymerase sigma factor SigA
Begin-End: 266-345
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
ETINKLSRTARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDEK
DSFYGDFIPDEHLPSPVDAA
Structures of the domain Q5SKW1 266-345
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kql X-ray 2.89 F 266-345 None
6l74 X-ray 3.12 F 266-345 None
4oir X-ray 3.1 F 266-345 None
6lts X-ray 3.45 F 266-345 None
6kqg X-ray 2.78 F 266-345 None
4g7z X-ray 3.81 P 266-345 None
4g7z X-ray 3.81 F 266-345 None
4g7o X-ray 2.99 P 266-345 None
4g7o X-ray 2.99 F 266-345 None
4g7h X-ray 2.9 P 266-345 None
4g7h X-ray 2.9 F 266-345 None
4oiq X-ray 3.62 F 266-345 None
4q4z X-ray 2.9 F 266-345 None
4q5s X-ray 3 F 266-345 None
4oin X-ray 2.8 F 266-345 None
4oip X-ray 3.4 F 266-345 None
6kqe X-ray 3.3 F 266-345 None
4oio X-ray 3.1 F 266-345 None
6ovr X-ray 2.84 F 266-345 None
5e17 X-ray 3.2 F 266-345 None
6kqn X-ray 3.49 F 266-345 None
5d4c X-ray 3.28 P 266-345 None
5d4c X-ray 3.28 F 266-345 None
5d4d X-ray 3 P 266-345 None
5d4d X-ray 3 F 266-345 None
5vo8 X-ray 3.3 F 266-345 None
6kqf X-ray 2.45 F 266-345 None
5d4e X-ray 3.08 P 266-345 None
5d4e X-ray 3.08 F 266-345 None
6kqm X-ray 3.2 F 266-345 None
5e18 X-ray 3.3 F 266-345 None
6kqh X-ray 3.18 F 266-345 None
5i2d X-ray 4.41 F 266-345 None
5i2d X-ray 4.41 Q 266-345 None
6kqd X-ray 3.3 F 266-345 None
6kqd X-ray 3.3 P 266-345 None
5voi X-ray 2.8 F 266-345 None
6wox X-ray 3.14 F 266-345 None
6woy X-ray 3 F 266-345 None


© NPIDB team 2003 - 2021

text