Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.26)
Uniprot AC: Q5UQ00
RecName: Probable formamidopyrimidine-DNA glycosylase
Begin-End: 2-119
Organism: Acanthamoeba polyphaga mimivirus
Interaction Mode:  S-Bb L-Bb L-Mj L-Mn 

Sequence:
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKF
LWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTF
Structures of the domain Q5UQ00 2-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4nrw X-ray 2.85 A 2-119  L-Bb L-Mj L-Mn 
4nrw X-ray 2.85 B 2-119  L-Bb L-Mj L-Mn 
3vk8 X-ray 2 B 2-119  L-Bb L-Mj L-Mn 
3vk8 X-ray 2 A 2-119  L-Bb L-Mj L-Mn 
3a46 X-ray 2.2 B 2-119  L-Bb L-Mj L-Mn 
3a46 X-ray 2.2 A 2-119  S-Bb L-Bb L-Mj L-Mn 
3vk7 X-ray 2.1 B 2-119  L-Bb L-Mj L-Mn 
3vk7 X-ray 2.1 A 2-119  S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text