Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: Q60867
RecName: Neurogenic differentiation factor 1
Begin-End: 102-154
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALS
Structures of the domain Q60867 102-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ql2 X-ray 2.5 B 102-154  H-Bb H-Mj L-Bb 
2ql2 X-ray 2.5 D 102-154  H-Bb H-Mj 
2ql2 X-ray 2.5 B 102-154  H-Bb H-Mj L-Bb 
2ql2 X-ray 2.5 D 102-154  H-Bb H-Mj 


© NPIDB team 2003 - 2021

text