Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: Q61473
RecName: Transcription factor SOX-17
Begin-End: 68-136
Organism: Mus musculus
Interaction Mode:   

Sequence:
IRRPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQ
HMQDHPNYK
Structures of the domain Q61473 68-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l6y X-ray 3 F 68-136  H-Bb H-Mj H-Mn L-Bb L-Mn 
6l6y X-ray 3 D 68-136  H-Bb H-Mj H-Mn L-Bb L-Mn 
3f27 X-ray 2.75 D 68-136 None
3f27 X-ray 2.75 D 68-136  H-Bb H-Mj H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text