Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q6AZJ8
RecName: Histone H2A
Begin-End: 15-91
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDN
KKTRIIPRHLQLAVRND
Structures of the domain Q6AZJ8 15-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3mgr X-ray 2.3 G 13-90 None
3mgr X-ray 2.3 C 15-90 None
3mgq X-ray 2.65 G 13-90 None
3mgq X-ray 2.65 C 15-90 None
6jyl X-ray 3.37 C 12-90  H-Bb S-Bb L-Bb 
6jyl X-ray 3.37 G 12-90  H-Bb S-Bb L-Bb 
3kxb X-ray 3.2 C 14-90 None
5z3u X-ray 4.31 G 12-90  H-Bb L-Bb 
5z3u X-ray 4.31 C 12-90  H-Bb S-Bb L-Bb 
3lel X-ray 2.95 C 15-90 None
3lel X-ray 2.95 G 13-90 None
3lel X-ray 2.95 Q 13-90 None
3lel X-ray 2.95 M 15-90 None
6k1p X-ray 3.87 G 12-90  H-Bb S-Bb L-Bb 
6k1p X-ray 3.87 C 12-90  H-Bb S-Bb L-Bb 
3mvd X-ray 2.9 G 12-90  H-Bb S-Bb L-Bb 
3mvd X-ray 2.9 C 12-90  H-Bb S-Bb L-Bb 
6jm9 X-ray 7.3 G 14-90 None
6jm9 X-ray 7.3 C 14-90 None
3lz0 X-ray 2.5 G 14-90 None
3lz0 X-ray 2.5 C 16-90 None
6ugm X-ray 3.7 G 12-90  H-Bb L-Bb 
6ugm X-ray 3.7 C 12-90  H-Bb L-Bb 
3mgp X-ray 2.44 G 13-90 None
3mgp X-ray 2.44 C 15-90 None
3lz1 X-ray 2.5 G 14-90 None
3lz1 X-ray 2.5 C 16-90 None
6esg X-ray 5.4 G 16-90 None
6esg X-ray 5.4 C 16-90 None
6esi X-ray 6.3 C 17-90 None
6esi X-ray 6.3 G 16-90 None
4kgc X-ray 2.69 G 14-90 None
4kgc X-ray 2.69 C 14-90 None
6esh X-ray 5.1 G 16-90 None
6esh X-ray 5.1 C 16-90 None
6uh5 X-ray 3.5 G 12-90  H-Bb S-Bb L-Bb 
6uh5 X-ray 3.5 C 12-90  H-Bb S-Bb L-Bb 
6esf X-ray 3.7 G 16-90 None
6esf X-ray 3.7 C 16-90 None
3mgs X-ray 3.15 G 13-90 None
3mgs X-ray 3.15 C 15-90 None
6j99 X-ray 4.1 G 13-90  H-Bb S-Bb L-Bb 
6j99 X-ray 4.1 C 11-90  H-Bb S-Bb L-Bb 
5z3v X-ray 4.22 G 12-90  H-Bb S-Bb L-Bb 
5z3v X-ray 4.22 C 12-90  H-Bb S-Bb L-Bb 
6jma X-ray 6.8 G 14-90 None
6jma X-ray 6.8 C 14-90 None
7at8 X-ray 4.4 J 14-90 None
7at8 X-ray 4.4 F 16-90 None
6vz4 X-ray 3.9 C 13-91  H-Bb S-Bb L-Bb 
6vz4 X-ray 3.9 G 13-91  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text